<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
13025D_P1 13025 Uganda 2004 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+NVP 48

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V D67G G190A, M230L   V35T, T39K, S48T, I50V, V60I, K102Q, K122E, D177E, I178M, T200I, E203G, Q207E, R211K E79V
>13025| codons 1-242
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICKEMEKEGKITKVGPENPYNTPI
FAIKKKGSTKWRKLVDFRVLNKRTQDFWEVQLGIPHPAGLKQKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMVI
YQYVDDLYVASDLEIGQHRIKIGELREHLLKWGFTTPDKKHQKEPPFLWLGYELHPDKWT
VQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, R41K, K55R, Y59C, H69Q, L89M  
>13025| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIRVRQCD
QILIEICGQKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Ndembi, N Viral rebound and emergence of drug resistance in the absence of viral load testing: A randomized comparison between zidovudine-lamivudine plus nevirapine and zidovudine-lamivudine plus abacavir. J Infect Dis, 2010