<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6615 CA16569 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 65
2 3TC+D4T+NFV 165
3 ABC+D4T+NVP 4

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N L10F, N88D N37ND, L63P, I64V, I72V, V77I, I93L  
>CA16569| codons 1-99
PQITLWQRPFVTIKIGGQLKEALLDTGADNTVLEEMDLPGRWKPKMIGGIGGFIKVRQYD
QIPVEICGHKAVGTVLIGPTPVNIIGRDLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67DN, M184V       K43KR, R83K, K122E, K154KE, E169D, G196E, Q207E, R211K, F214L, A272P, K277R, E297Q  
>CA16474| codons 1-299
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEREGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWEGSPAIFQSSMTKILDPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRTKIEELREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTQEA

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001