<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5177 CA16565 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T 57
2 3TC+D4T+IDV 35
3 AZT+DDC+NFV 26
4 AZT+DDI+RTV+SQV 17
5 3TC+ABC+EFV 26
6 3TC+D4T+IDV+RTV 43
7 3TC+ABC+D4T+IDV+RTV 17
8 3TC+ABC+AZT+EFV 7

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82T, L90M F53L I15V, K20M, M36I, L63P, I66F, A71V  
>CA16565| codons 11-99
VTIKVGGQLMEALLDTGADDTVLEEINLPGRWKPKMIGGIGGLVKVRQYDQIPIEFCGHK
VIGTVLVGPTPTNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, Q151M A62V, V75I, F77L, F116Y     K49KR, K122E, V245I, E248D, V276VI, Q278H, K281R, L283I, T286A, I293V, F346Y, R356K, K390R, E432D, L491S, K527Q, A554S A299AG
>CA16470| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISRIGPENPYNTPV
FVIKRKDSTKWRKLIDLRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYYSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIILPDKDSWTVNDIQKLVGKLNWASQIYAGIKIKHLCRLIRGAKALTEVVPLTEEGE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPYKNLKTGKYAKMRGA
HTNDVKQLTEAVQKIATESIVIWGKTPKFRLPIQKETWEAWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKDPIVGAETFYVDGAANRETKLGKAGYVTDRGRQKVVSLTDTTNQKTELQ
AIHLALQDSGSEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLIQKEKVYLAWVPAHK
GIGGNEQVDKLVSSGIRKVL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005