<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
  L68V E11D, K14R, V31I, M50L, I72IV, L101I, T112V, S119P, T122I, T124A, T125A, G134D, G163V, D167E, V201I, T206S, I208M, T218I, L234I, D256E S283G
>06CM-BA-040| codons 1-288
FLDGIDKAQEDHERYHSNWRAMASDFNLPPIVAKEIVASCDKCQLKGEALHGQVDCSPGI
WQLDCTHVEGKVILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKVIHTDNGPN
FISAAVKAACWWADIKQEFGIPYNPQSQGVVESMNKELKKIIVQVREQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIASDMQTKELQKQIIKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSEIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, L19IM, K20I, E35Q, M36I, N37D, R41K, C67M, H69K, V82I, L89M  
>06CM-BA-040| codons 1-99
PQITLWQRPLVTVKIGGQMIEALLDTGADDTVLEQIDLPGKWKPKMIGGIGGFIKVRQYD
QILIEIMGKKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V21I, V35T, T39N, V60I, K104R, D123E, I135T, K173A, D177E, T200A, R211K, V245K, D250E, A272S, K281R, E291D, V292I, I293V, E297A, K311R, E312N, L325I, G335D, F346H, R356K, M357R, R358G, G359S, A376S, T386V, K390R, A400T, E432D, V435I, R461K, D471E, Q480H, H483Y, L491T, L517I, S519N, A534S, A554N, K558R R172RT
>06CM-BA-040| codons 1-560
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALTEICNEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKRSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFTAQNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKESWTVNDIQKLVGKLNWASQIYSGIKVKQLCRLLRGTKALTDIVPLTAEAE
LELAENREILRNPVHGVYYDPSKDIIAEIQKQGQDQWTYQIYQEPHKNLKTGKYAKRGSA
HTNDVKQLTEAVQKISTESIVIWGKVPKFRLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKDPIIGAETFYVDGAANRETKLGKAGYVTDKGRQKVVSLTETTNQKTELH
AIYLALQDSGTEVNIVTDSQYALGIIQAQPDKSESEIVNQIIEQLIKKEKVYLSWVPAHK
GIGGNEQVDKLVSNGIRRVL

References
Author Title Citation
Luk, KC Near full-length genome characterization of an HIV type 1 CRF25_cpx strain from Cameroon. ARHR, 2008