<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    K14R, V31I, A80S, Q95P, T112V, T124N, T125A, K136Q, E157Q, K160Q, V201I, L234I S283G
>04CA7750| codons 1-288
FLDGIDKAQEEHERYHSNWRAMASDFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVSSGYIEAEVIPAETGPETAYFLLKLAGRWPVKVIHTDNGSN
FTSNAVKAACWWAGIQQEFGIPYNPQSQGVVESMNKQLKQIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, K14R, G16E, E35D, M36I, R41K, R57K, L63T, H69K, K70R, L89M  
>04CA7750| codons 1-99
PQITLWQRPVVTVRIEGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QITIEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E28A, V35T, E44D, W88*, K103R, K122E, D123S, S162C, K173T, Q174H, D177E, T200A, Q207E, R211K, F214L, V245Q, A272P, E291D, V292I, I293V, E297A, Q334H, G335D, R356K, M357R, G359A, T369A, K390R, A400T, E404D, V435L, A446S, L452I, V466I, D471E, T477A, H483Q, L491S, V493A, K512N, L517I, S519N, K530R, A534S, A554N  
>04CA7750| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTAEKIKALTEICTEMEKDGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDF*EVQLGIPHPAGLKKRKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRTHNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTDIVPLTAEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGHDQWTYQIYQEPFKNLKTGKYAKRRAA
HTNDVKQLAEAVQKIATESIVIWGKTPKFRLPIQKETWETWWTDYWQATWIPEWEFVNTP
PLVKLWYQLEKEPILGAETFYVDGASNRETKIGKAGYVTDRGRQKIVSLTETTNQKAELQ
AIQLALQDSGSEANIVTDSQYALGIIQAQPDNSESEIVNQIIEQLIKKERVYLSWVPAHK
GIGGNEQVDKLVSNGIRKVL

References
Author Title Citation
Ntemgwa, M Near full-length genomic analysis of a novel subtype A1/C recombinant HIV type 1 isolate from Canada. ARHR, 2008