<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5242 CA16542 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 25
2 None 104
3 IDV+ D4T+ 3TC 104
4 None 20
5 DDI+ D4T+ NFV 78

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A L10F I13V, I62V, L63P, A71V  
>CA16542| codons 1-99
PQITLWQRPFVTVKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFVKVRQYD
QVPIEICGHKVIGTVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Q151M     V179D V35I, V118I, K122E, I135T, I142V, T200A, F214L, K277R, I293X L301LV
>CA16447| codons 1-302
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGVRYQYNVLPMGWKGSPAIFQSSMTKILEPFRKQNPDIDI
YQYMDDLYVGSDLEIGQHRAKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKALTEVXPLTEEAE
VE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005