<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4516 CA16536 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 5
2 3TC+AZT+SQV 6
3 3TC+AZT+IDV 9
4 3TC+D4T+IDV 101
5 NVP+DDI+NFV 7
6 DLV+DDI+NFV 29
7 EFV+DDI+NFV 32
8 ABC+D4T+Unknown+APV+NFV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    Q7QE, L63P, E65D, A71AV, I72IM, V77I P9PR
>CA16536| codons 1-99
PQITLWERRLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIDICGHKVMGTVLIGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        A98S, D123E, I142V, I178L, G196E, T200A, A272S, T286A, V292I, E297K K281KN, A299AG
>CA16440| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDLVI
YQYMDDLYVGSDLEIEQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYSGIKVKQLCNLLRGAKALTEIIPLTKEGE

References
Author Title Citation
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005