<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6593 CA16533 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI|PI NA
2 Unknown 52

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54L, I84V, L90M V11I, L33F, Q58E L10I, T12I, I13V, R41K, I62V, L63P, A71I, V77I, I93L  
>CA16533| codons 1-99
PQITLWQRPIIIVKIGGQLKEALLDTGADDTVFEEMNLPGKWKPKMIGGIGGFLKVREYD
QVPIEICGHKIIGTVLIGPTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Y115F, Q151M, M184V A62V, K70KN, V75I, F77L, F116Y   V108VI V35I, K46Q, T58N, S68G, V118I, K122E, I135R, T200A, R211Q, F214L, V245T, I293V  
>CA16437| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGQISKIGPENPYNNPV
FVIKKKDGTNWRKLIDLRELNKRTQDFWEVQLGIPHPAGLKKKKSVTILDVGDAFYSIPL
DEDFRKYTAFTIPSRNNETPGIRYQYNVLPMGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELRQHLLQWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPITLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTEEAE

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001