<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AE-Int-143 AE-Int-143 Thailand 2006 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    E11D, A21T, V31I, S39N, I72V, T112V, T125A, G134N, I135V, K136R, V165I, D167E, V201I, L234I S283G
>AE-Int-143| codons 1-288
FLDGIDKAQEDHEKYHSNWRTMASDFNLPPIVAKEIVANCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKVIHTDNGSN
FTSTAVKAACWWANVRQEFGIPYNPQSQGVVESMNKELKKIIGQIREQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

References
Author Title Citation
Isarangkura-Na-Ayuthaya, P Appearance of drug resistance-associated mutations in human immunodeficiency virus type 1 CRF01_AE integrase derived from drug-naive Thai patients. ARHR, 2010