<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6591 CA16531 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 8
2 AZT+DDC 43
3 AZT 21
4 D4T 17
5 AZT+3TC 26
6 AZT+3TC+RTV 8
7 AZT+3TC 43
8 D4T+DDI+NFV 17
9 AZT+DDI+3TC 78
10 DDC+DDI+EFV+3TC 21
11 D4T+3TC+RTV+SQV 46

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A, L90M F53L L10V, I15V, R41K, L63P, V77I  
>CA16531| codons 1-99
PQITLWQRPVVTIKVGGQLKEALLDTGADDTVLEEMNLPGKWKPKIIGGIGGLVKVRQYD
QIPIEICGHKAIGTVLIGPTPANIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y       V35M, T39A, K43Q, E44D, S68G, V118I, K122E, D123N, I135T, R211K, A272P, K277R  
>CA16435| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICAELEQDGKISKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAE

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005