<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6589 CA16528 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 279
2 3TC+D4T+NFV 48
3 3TC+AZT+IDV 35
4 EFV+RTV+SQV 37

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, I54V, L90M L10F, L33I, N88D K20R, E35D, M36I, R57K, L63P, C67CY, A71AT, I93L  
>CA16528| codons 1-99
PQITLWQRPFVTIKIGGQLREALLDTGADNTVIEDINLPGRWKPKMIGGIGGFVKVKQYD
QIPIEIYGHKTIGTVLVGPTPVNIIGRDLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W T215C K103N V108I, L234LI T7P, K20R, V35L, T39K, K43E, K122E, I135T, G196E, T200A, Q278H  
>CA16432| codons 1-284
PISPIEPVPVKLKPGMDGPRVKQWPLTEEKIKALLEICKELEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIEQHRAKIEELRQHLWRWGFCTPDKKHQKEPPFLWMGYEIHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKHLCKLLR

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009