<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, G17E, K20I, M36I, N37S, R41K, L63P, H69K, K70R, L89I  
>1727HALD| codons 1-99
PQITLWQRPLVTVRIGEQLIEALLDTGADDTVLEEISLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKRAIGTVLVGPTPVNIIGRNILTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
      V108I V35T, K49R, D123E, I135V, S162A, K173T, Q174K, D177E, I178V, T200A, Q207E, V245Q, L246M, R284K, T286A, E291D, V292I, I293V, P294T, S322T, G335D, R356K, M357R, G359S, V365I, I375V, T377I, K390R, T403M, E432D  
>1727HALD| codons 1-433
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTILDVGDAYFSVPL
DKEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEVVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQMPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLKGAKALTDIVTLTEEAE
LELAENREILKEPVHGVYYDPTKDLIAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKRRSA
HTNDIKQLTEAVQKVAIESIVIWGKTPKFRLPIQKETWEAWWMEYWQATWIPEWEFVNTP
PLVKLWYQLEKDP

References
Author Title Citation
Diop-Ndiaye, H Antiretroviral drug resistance mutations in antiretroviral-naive patients from Senegal. ARHR, 2010