<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6584 CA16506 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+DDI+NFV 88

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N L10LF, N88D L19I, N37C, I62V, L63A, A71AT, V77I, I93L  
>CA16506| codons 1-99
PQITLWQRPFVTIKIGGQIKEALLDTGADNTVLEEMCLPGRWKPKMIGGIGGFIKVRQYD
QVAIEICGHKTIGTVLIGPTPVNIIGRDLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T215SY A62AV     L34LI, K49R, V75X, V90VI, V118I, D123E, T165I, Q174E, F214L, A272P, I274IV, I293V  
>CA16425| codons 1-298
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKAIVEICTEMEKEGKISRIGPENPYNTPV
FVIKKKDSTKWRKLXDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMIKILEPFRKENPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLSTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGVKVKQLCKLLRGTKALTEVVPLTEE

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005