<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 PI | RTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, I50L, V82A L33F, N88D L10V, I13V, I15V, K20R, E35D, M36L, R41K, K45Q, R57K, Q61N, L63P, I64L, A71V, I93L  
>07BR_FPS810| codons 1-99
PQITLWQRPVVTVKVGGQLREALLDTGADNTVFEDLNLPGKWKPQMIGGLGGFIKVKQYD
NIPLEICGHKVIGTVLVGPTPANIIGRDLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74V, M184V, L210W, T215Y K219E, N348I L100I, K103N   E6N, K20R, V35T, T39A, E44D, V60I, V118I, K122E, I135V, S162Y, K173T, Q174K, D177N, E203K, Q207E, H208Y, R211K, D218E, L228H, Q242H, V245Q, E248D, A272P, T286A, E291D, V292I, I293V, P294S, E297V, R356K, G359S, K390R, Q394L, A400T, K431T, V435A, A446S, N447S, L452K, V466A, V467I, S468T, D471E, T477A, H483Q, L491S, S519N, E529D, V531I, A534S, V559I  
>07BR_FPS810| codons 1-560
PISPINTVPVKLKPGMDGPRVKQWPLTEEKIKALTEICAELEKDGKISKIGPENPYNTPI
FAIKKKNSTRWRKVVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRTKNPNIVI
YQYVDDLYVGSDLEIGQHRTKIKELREYLWKWGFYTPEEKHQKEPPFHWMGYELHPDKWT
VHPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVSLTVEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKILKTGKYAKMRSA
HTNDVKQLTEAVQKIATESIVIWGKTPKFRLPILKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLETEPIAGAETFYVDGASSRETKKGKAGYVTDRGRQKAITLTETTNQKAELQ
AIQLALQDSGSEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKDKIYLSWVPAHK
GIGGNEQVDKLVSAGIRKIL

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
  G163R S17N, R20K, I84L, S119A, T124A, T125A, K136Q, K156N, V201I, A205S, L234V, D256E S283G
>07BR_FPS810| codons 1-288
FLDGIDKAQEEHEKYHNNWKAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYLEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGAN
FTSAAVKAACWWAGIQQEFGIPYNPQSQGVVESMNNELKKIIRQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIISTDIQTKELQKQITKIQNFRVYYRDSRDPVWKGPAK
LLWKGEGAVVIQDNSEIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

References
Author Title Citation
Sanabani, SS Characterization and frequency of a newly identified HIV-1 BF1 intersubtype circulating recombinant form in Sao Paulo, Brazil. Virology J, 2010