<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 PI | RTI NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
  G163K E10D, S39A, I84L, L101I, S119T, T124A, T125A, K136Q, V201I, A205S, K211R, T218I, L234V, D256E S283G
>07BR_FPS625| codons 1-288
FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVAACDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYLEAEVIPAETGQETAYFILKLAGRWPVKTIHTDNGTN
FTSAAVKAACWWAGIQQEFGIPYNPQSQGVVESMNKELKKIIKQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIISTDIQTRELQKQIIKIQNFRVYYRDSRDPVWKGPAK
LLWKGEGAVVIQDNSEIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, K20R, E35D, M36I, R41K, R57K, Q61D, L89M  
>07BR_FPS625| codons 1-99
PQITLWQRPLVTIKVGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
DILIEICGHKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, K20R, V35T, T39A, K104R, K122Q, I135V, S162C, K173A, Q174K, D177E, Q207N, R211K, V245Q, E248N, D250E, A272P, K275R, T286A, E291D, V292I, I293V, P294S, E297A, I329L, R356K, G359S, A376S, T377L, T386I, Q394L, E399D, A400T, K431T, V435A, A446S, L452K, V466A, D471E, T477S, H483Q, L491S, K512Q, E516D, S519N, Q524L E29K
>07BR_FPS625| codons 1-560
PISPIDTVPVKLKPGMDGPRVKQWPLTEKKIKALTEICAEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKRSVTVLDVGDAYFSVPL
DQDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRAKNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELRNHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPNKESWTVNDIQKLVGKLNWASQIYPGIRVKQLCKLLRGAKALTDIVSLTAEAE
LELAENREILKEPVHGVYYDPSKDLIAELQKQGQGQWTYQIYQEPFKNLKTGKYAKMRSA
HTNDVKQLTEAVQKISLESIVIWGKIPKFKLPILKETWDTWWTEYWQATWIPEWEFVNTP
PLVKLWYQLETEPIAGAETFYVDGASNRETKKGKAGYVTDRGRQKAVSLTETTNQKSELQ
AIQLALQDSGSEVNIVTDSQYALGIIQAQPDQSESDLVNQIIELLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSAGIRKVL

References
Author Title Citation
Sanabani, SS Characterization and frequency of a newly identified HIV-1 BF1 intersubtype circulating recombinant form in Sao Paulo, Brazil. Virology J, 2010