<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6559 CA16483 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 13
2 AZT+DDI 44
3 3TC+AZT+IDV 57
4 3TC+AZT+NFV 76

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, M46I N88D R41K, V77I  
>CA16483| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADNTVLEEMNLPGKWKPKIIGGIGGFIKVRQYD
QILIEICGHKAIGTVLIGPTPVNIIGRDLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y       V35M, A98S, K122E, I135T, E169D, D177E, I293V A299AG, L301LV
>CA16388| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLWRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTEEGE
VEL

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001