<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
  Y143YF E11D, D25E, V31I, I72V, L101I, T112R, T125V, K136Q, V201I, L234I, D256E, R269K, D278A S283G, R284G
>07ZA17332| codons 1-288
FLDGIDKAQEDHEKYHSNWRAMASEFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKRIHTDNGSN
FTSTVVKAACWWAGIQQEFGIPFNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSEIKVVPRRKAKIIKDYGKQMAGADCVAGGQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15IV, L19V, E35D, M36I, R41K, H69K, T74S, L89M, I93L  
>07ZA17332| codons 1-99
PQITLWQRPLVSIKVGGQVKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGSVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        P14PT, V35T, E36EA, T39KQ, S48T, V60I, K122E, D123EG, K173A, D177E, T200A, I202V, Q207A, R211K, V245Q, K277R, T286A, E291D, V292I, I293V M16MK, G93GA, L100L*
>07ZA17332| codons 1-304
PISPIETVPVKLKTGKDGPKVKQWPLTEEKIKALTAICQEMEKEGKITKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLAIPHPAG*KKKKSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAQNPEIVI
YQYMDDLYVGSDLEIGQHRAKVEELRAHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGAKALTDIVPLTEEAE
LELA

References
Author Title Citation
Papathanasopoulos, MA Characterization of HIV type 1 genetic diversity among South African participants enrolled in the AIDS vaccine integrated project (AVIP) study. ARHR, 2010