<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6557 CA16481 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDC 78
2 AZT+DDC 22
3 3TC+AZT+DDC+SQV 78
4 None 31
5 3TC+D4T+NFV 122

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N L33LF, N88D D60E, A71V, V77I  
>CA16481| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADNTVFEEMNLPGRWKPKMIGGIGGFIKVRQYE
QILIEICGHKVIGTVLIGPTPVNIIGRDLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       K122E, T139M, S162C, V179VI, I202IM, D250E  
>CA16386| codons 1-257
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNEMPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIII
YQYVDDLYVGSDLEIGQHRTKMEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKESWTVNDI

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005