<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI|NRTI|PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69DN       E44D, A98S, V118I, I142V  
>Ir-HIV-DR-26| codons 1-168
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKDGKISKIGPENPYNTPV
FAIKKKDSNKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKIL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   L10V, I13V, I15V, G16E, K20I, M36V, I62V, L63N, I64M, A71V, V77I, I93L  
>Ir-HIV-DR-26| codons 1-99
PQITLWQRPVVTVKVEGQLIEALLDTGADDTVLEEVNLPGRWKPKMIGGIGGFIKVRQYD
QVNMEICGHKVIGTVLIGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Hamkar, R Assessing subtype and drug-resistance-associated mutations among antiretroviral-treated HIV-infected patients. AIDS, 2010