<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI|NRTI|PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L76V, I84V, L90M L10F, L33I, Q58E, L89V I13V, K20M, M36I, I62V, L63P, A71T, P79A, Q92K  
>Ir-HIV-DR-23| codons 1-99
PQITLWQRPFVTVKIGGQLMEALLDTGADDTVIEEINLPGRWKPKIIGGIGGFIKVREYD
QVPIEICGHKTIGTVVVGATPVNVIGRNVMTKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y V75M Y181C, G190A P225H, K238T S68G, T69A, L100X, K101Q, K122E, I135T, I142V, T286A, I293V, T296S, E297K, K311R D320L
>Ir-HIV-DR-23| codons 1-322
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDGAKWRKLMDFRELNKRTQDFWEVQLGIPHPAGXQKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYMDDLYVASDLEIGQHRTKIEELRQHLWRWGFYTPDKKHQKEHPFLWMGYELHPDTWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVVPLSKEAE
LELAENREILREPVHGVYYLPS

References
Author Title Citation
Hamkar, R Assessing subtype and drug-resistance-associated mutations among antiretroviral-treated HIV-infected patients. AIDS, 2010