<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI|NRTI|PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88D T12N, K20T, L63P, V77I I13R, K14D
>Ir-HIV-DR-13| codons 1-99
PQITLWQRPLVNRDIGGQLTEALLDTGADNTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLIGPTPVNIIGRDLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V, T215Y K219R   P225H K49R, R83K, D123E, I135L, K166R, R172K, K173N, Q174K, D177E, T200S, E204D, K277R, Q278E, I293V, E297K, Q330R D86T, P95T, R143K, I159L, K331T
>Ir-HIV-DR-13| codons 1-332
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQTFWEVQLGITHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSLNNETPGIKYQYNVLPQGWKGSPALFQSSMTRILEPFKNKNPEIVI
YQYVDDLYVGSDLEIGQHRSKIEDLRQHLLRWGFYTPDRKHQKEHPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRELCKLLRGTKALTEVVPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEIRTQ

References
Author Title Citation
Hamkar, R Assessing subtype and drug-resistance-associated mutations among antiretroviral-treated HIV-infected patients. AIDS, 2010