<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI|NRTI|PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I54V, V82T, I84V, L90M V11I, L33F L10V, I13V, I15V, G16E, K20R, M36I, N37S, L63P, I66F, A71V, I72V, T91S  
>Ir-HIV-DR-10| codons 1-99
PQITLWQRPVITVKVEGQLREALLDTGADDTIFEEISLPGRWKPKIIGGIGGFVKVRQYD
QIPIEFCGHKVVGTVLVGPTPTNVIGRNLMSQIGCTLNF

References
Author Title Citation
Hamkar, R Assessing subtype and drug-resistance-associated mutations among antiretroviral-treated HIV-infected patients. AIDS, 2010