<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
6 Ir-HIV-DR-06 Iran 2009 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI|NRTI|PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14I, L19Q, K20R, E35D, M36I, R41K, R57K, H69K, L89M  
>Ir-HIV-DR-06| codons 1-99
PQITLWQRPLVTVIIGGQQREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Hamkar, R Assessing subtype and drug-resistance-associated mutations among antiretroviral-treated HIV-infected patients. AIDS, 2010