<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
4 Ir-HIV-DR-04 Iran 2009 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI|NRTI|PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   I13V, Q18L, K20T, L63P, A71V, I72V, V77I  
>Ir-HIV-DR-04| codons 1-99
PQITLWQRPLVTVKIGGLLTEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKVVGTVLIGPTPVNIIGRNLMTQIGCTLNF

References
Author Title Citation
Hamkar, R Assessing subtype and drug-resistance-associated mutations among antiretroviral-treated HIV-infected patients. AIDS, 2010