<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
2 Ir-HIV-DR-02 Iran 2009 HIV1 CRF35_AD Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI|NRTI|PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14I, L19Q, K20R, E35D, M36I, R41K, R57K, H69K, L89M  
>Ir-HIV-DR-02| codons 1-99
PQITLWQRPLVTVIIGGQQREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103N E138K, P225H K11R, V35R, V60I, T131X, I135T, S162C, D177E, I178L, V179I, T200I, Q207A, R211K, D250E, A272P, L283I, V292I, I293V, I326M, I341F, F346Y, G352X, A355E, R356K N136L, N137R, T139N
>Ir-HIV-DR-02| codons 1-356
PISPIETVPVRLKPGMDGPKVKQWPLTEEKIKALREICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFXIPSTLRKNPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPELII
YQYVDDLYVGSDLEIGQHRIKIEELRAHLLKWGFTTPDKKHQKEHPFLWMGYELHPDKWT
VQPIVLPEKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLIRGTKALTEIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLMAEIQKQGQGQWTYQFYQEPYKNLKTXKYEK

References
Author Title Citation
Hamkar, R Assessing subtype and drug-resistance-associated mutations among antiretroviral-treated HIV-infected patients. AIDS, 2010