<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
p022 Dip022 Brazil 2007 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 AZT NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, T12K, I15V, L19I, E35D, M36I, P39T, R41K, R57K, D60E, Q61D, L63I, L89M  
>Dip022| codons 1-99
PQITLWQRPVVKIKVGGQIKEALLDTGADDTVLEDINLTGKWKPKMIGGIGGFIKVKQYE
DIIIEICGHKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V21I, V35T, T39K, E40D, K49R, V60I, I135V, S162C, E169D, K173V, Q174K, T200A, Q207A, R211K, V245Q, E248D, A272P, K281R, T286A, E291D, V292I, I293V, E297A, A327V  
>Dip022| codons 1-335
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALTEICKDMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRVKNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLLRGAKALTDIVPLTAEAE
LELAENREILKEPVHGVYYDPSKDLIVEIQKQGQG

References
Author Title Citation
Ferreira, FG Prevalence of primary drug resistance-associated mutations among HIV type 1 vertically infected children in Belo Horizonte, Brazil. ARHR, 2010