<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, L210W, T215Y   Y181C A98G, V108I I5V, E28K, K32E, V35T, E36A, T39K, K43E, D86E, V118I, D121H, K122E, I135T, I142V, S162Y, K173T, Q174K, D177E, V179I, T200A, I202V, Q207D, R211K, H221Y, V245Q, T286A, E291D, V292I, I293V, P294T, E312D, I326V  
>ZZR40| codons 1-334
PISPVETVPVKLKPGMDGPKVKQWPLTKEKIEALTAICKELEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQEFWEVQLGIPHPGGLKKKKSVTILDVGDAYFSIPL
HEDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQYSMTKILEPFRTKNPEIII
CQYVDDLYVGSDLEIGQHRAKVEELRDHLWKWGFYTPDKKYQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVTLTEEAE
LELAENREILKDPVHGVYYDPSKDLVAEIQKQGQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, K14R, G16E, K20R, E35D, M36I, R41K, H69K, L89M  
>ZZR40| codons 1-99
PQITLWQRPVVTVRIEGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Hawkins, CA Clinical and genotypic findings in HIV-infected patients with the K65R mutation failing first-line antiretroviral therapy in Nigeria. JAIDS, 2009