<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4127 CA16410 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T 69
2 3TC+D4T+IDV 61
3 3TC+D4T+NFV+NVP 31
4 3TC+D4T+NFV+RTV+SQV 69
5 3TC+ABC+APV 50

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V, V75T, M184V A62V K103N, Y181C   V35IT, A98S, D123E, Q174R, I178L, V179I, Q207E, R211K, V245Q, I293V, E297V  
>CA16410| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FVIKKKDSTKWRKVTDFRELNKRTQDFWEVQLGIPHPSGLKKNKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKRNPDLII
CQYVDDLYVGSDLEIGQHRTKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTVEAE
L

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54ILM, I84V, L90M V11I, F53FL L10I, I13V, K20I, K55R, L63P, A71I, I72IT, Q92QKR  
>CA16523| codons 1-99
PQITLWQRPIITVKIGGQLIEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGLLRVRQYD
QIPIEICGHKITGTVLVGPTPVNVIGRNLMTKIGCTLNF

References
Author Title Citation
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005