<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6574 CA16408 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 39
2 AZT+DDI 78
3 3TC+D4T+IDV 78
4 AZT+NVP+RTV+SQV 65
5 ABC+APV+D4T+EFV 61
6 ABC+APV+D4T+EFV 11

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y K219KN K101KE, K103KN, Y181C, G190A A98G V60I, K122E, I135T, I142V, Q174K, G196E, E203EK, Q207E, L228HR, A288S, I293V  
>CA16408| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPGGLEKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKKNPDIVI
CQYMDDLYVASDLEIEQHRTKIKELREHLWRWGFYTPDNKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKSLTEVVPLTEEAE
LEL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M G73AT L10LI, N37S, L63P, V77I, I93L  
>CA16521| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKIIGGIGGFIKVRQYD
QIPIEICGHKAIATVLIGPTPVNVIGRNLMTQLGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009