<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6562 CA16392 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 108
2 3TC+DDI 31
3 3TC+DDI+NFV 13
4 3TC+DDI+SQV 78
5 3TC+D4T+NVP+SQV 45

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   Y181C   K20R, V35I, I142V, D177E, G196E, R211G, A288S, P313PT, V317VA, D324DE, G333GE, Q334QL, M357MIT, A371AV, I375IV, A376ST, T386TA, A400T, V435E, D460DN, V467VI, S468SP, T470TA, K476KR, H483HY, K530KR, A554AS R284RI
>CA16392| codons 1-560
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
CQYVDDLYVGSDLEIEQHRTKIEELRQHLLGWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLIGTKSLTEVIPLTEEAE
LELAENREILKETVHGAYYDPSKELIAEIQKQELGQWTYQIYQEPFKNLKTGKYARTRGA
HTNDVKQLTEVVQKVTTESIVIWGKAPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIEGAETFYVDGAANRETKLGKAGYVTNRGRQKVIPLADTTNQRTELQ
AIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLIKKERVYLAWVPAHK
GIGGNEQVDKLVSSGIRKVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I62V, L63P, V77I, F99L  
>CA16487| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNL

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001