<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI|NRTI|PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67DGNS, K70R K219Q, N348NI K103N, G190A   V21VF, V35T, T39D, E40EG, S48T, V60I, K122E, D123S, I135T, I142IV, S162A, E169D, T200R, E203D, R211K, V245Q, A272P, E291D, V292I, I293V, I326V, G335D, F346G, R356K, G359T, K366R, T377L P19S
>188418| codons 1-386
PISPIETVPVKLKPGMDGSKFKQWPLTEEKIKALTEICDGMEKEGKITKIGPENPYNTPI
FAIKKKSSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQASMTKILDPFRKQNPDIVI
YQYMDDLYVASDLEIGQHRRKIDELRQHLLKWGFTTPDQKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLVAEIQKQGQDQWTYQIYQEPGKILKTGKYAKMRTA
HTNDVRQLTEAVQKIALESIVIWGKT

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, G16A, N37R, R41N, H69K, L89M, I93L  
>188418| codons 1-99
PQITLWQRPLVTIKVAGQLKEALLDTGADDTVLEEMRLPGNWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Jones, LR In-depth analysis of the origins of HIV type 1 subtype C in South America. ARHR, 2009