<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI|NRTI|PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, M36I, N37K, R41N, L63V, H69K, T74S, L89M, I93L  
>176988| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEEIKLPGNWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGSVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103N P225H V35T, E36A, T39E, S48T, T69TP, K122E, D123N, I135M, K173T, D177E, T200A, Q207A, R211K, V245Q, A272P, K277R, E291D, V292I, I293V, G335D, R356K, G359T, K366R, T377Q, G384GE T253TA
>176988| codons 1-386
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSPKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSMNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTQNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELRAHLLKWGFTTPDKKHQKEHPFLWMGYELHPDKWT
VQPIQLPEKDSWAVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKMRTA
HTNDVRQLTEAVQKIAQESIVIWEKT

References
Author Title Citation
Jones, LR In-depth analysis of the origins of HIV type 1 subtype C in South America. ARHR, 2009