<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI|NRTI|PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y       K20R, V35T, T39E, V118VI, I135T, E138A, I142T, P170PL, R172K, K173I, Q174K, D177E, T200A, E203K, Q207A, H208HY, R211K, K223KE, V245Q, E248ED, A272P, K277R, Q278H, E291D, V292I, I293V, S322A, G333E, Q334C, R356K, G359T, V365VI, S379A Q151QR, G152GE
>198227| codons 1-386
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICEELEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSTNNATPGTRYQYNVLPREWKGSPAIFQSSMTKILELFKIKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIKELRAYLWKWGFYTPDKKHQEEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVRHLCKLLRGTKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPAKDLIAEIQKQECGQWTYQIYQEPFKNLKTGKYAKMRTA
HTNDIKQLTEAVQKIATEAIVIWGKT

References
Author Title Citation
Jones, LR In-depth analysis of the origins of HIV type 1 subtype C in South America. ARHR, 2009