<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI|NRTI|PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A L24I, K43T L10V, E35D, M36I, N37S, K55KR, R57K, I62V, L63P, I64V  
>BRGO3107| codons 1-99
PQITLWQRPVVTIKIGGQLKEALIDTGADDTVLEDISLPGRWTPKIIGGIGGFVRVKQYD
QVPVEICGHKAIGTVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, T215Y   K101E, Y181C, G190A V108I K20R, K32Q, K122E, E138A, H221Y, V245T  
>BRGO3107| codons 1-246
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIQALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTILDVGDAYFSVPL
DEDFRKYTAFTIPSINNATPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYVDDLYVASDLEIGQHRTKIEELRQHLLRWGFYTPDKKYQKEPPFLWMGYELHPDKWT
VQPITL

References
Author Title Citation
Cardoso, LP High level of multidrug resistance mutations in HIV type 1 pol gene and resistance-associated mutations to enfuvirtide (T-20) among antiretroviral-experienced patients from central Brazil. ARHR, 2009