<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI|NRTI|PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V V75M, T215V, K219Q L100I, K103N   K20R, T27S, K46Q, V60I, T69N, K104R, K122E, I135T, D177N, I202V, H208HY, R211K, H221HY, L228H  
>BRGO3102| codons 1-249
PISPIETVPVKLKPGMDGPRVKQWPLSEEKIKALVEICTEMEKEGQISKIGPENPYNTPI
FAIKKKNSNRWRKLMDFRELNKRTQDFWEVQLGIPHPAGIKKNRSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPNIVI
YQYVDDLYVGSDLEIGQHRTKVEELRQYLLKWGFVTPDQKYQKEPPFHWMGYELHPDKWT
VQPIVLPEK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, I54V, V82S L10F, L24I, L33I I13V, L19I, K20M, M36I, N37D, I62V, L63P, I64V, T74S, V75I  
>BRGO3102| codons 1-99
PQITLWQRPFVTVKIGGQIMEALIDTGADDTVIEEIDLPGRWKPKIIGGIGGFVKVRQYD
QVPVEICGHKAIGSILVGPTPSNIIGRNLLTQIGCTLNF

References
Author Title Citation
Cardoso, LP High level of multidrug resistance mutations in HIV type 1 pol gene and resistance-associated mutations to enfuvirtide (T-20) among antiretroviral-experienced patients from central Brazil. ARHR, 2009