<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI|NRTI|PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, L74I, M184V, T215F K219Q V106VA, G190AV   V35L, K43R, T69N, K101Q, K122E, D123S, Q174K, N175Y, R211A  
>BRGO3039| codons 1-243
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALLEICTEMEREGKISKIGPENPYNTPV
FAIKKKNSNRWRKIVDFRELNKRTQDFWEVQLGIPHPAGLQKKKSATVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKKYPDIVI
YQYVDDLYVVSDLEIGQHRTKIEELRQHLLAWGFFTPDQKHQKEPPFLWMGYELHPDKWT
VQP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, V82A, L90M L33I, K43T L10I, L19I, K20R, E35D, N37S, R41K, K55R, R57K, L63P, A71V, V77I, I85V, I93L  
>BRGO3039| codons 1-99
PQITLWQRPIVTIKIGGQIREALLDTGADDTIIEDMSLPGKWTPKIVGGIGGFIRVKQYD
QIPIEICGHKVIGTVLIGPTPANIVGRNLMTQLGCTLNF

References
Author Title Citation
Cardoso, LP High level of multidrug resistance mutations in HIV type 1 pol gene and resistance-associated mutations to enfuvirtide (T-20) among antiretroviral-experienced patients from central Brazil. ARHR, 2009