<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 PI | RTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14R, I15V, G17E, K20T, E35D, M36I, R57K, Q61N, E65D, L89M L10G
>07BR844| codons 1-99
PQITLWQRPGVTIRVGEQLTEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVKQYD
NILIDICGHKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R T215I, K219E K103N V108I V35M, K49R, I135L, E169D, K173T, Q174K, T200A, E203D, Q207E, R211K, V245Q, E248D, A272P, T286A, E291D, V292I, I293V, E297A, V317A, R356K, G359S, T377V, Q394L, E399D, A400T, E404D, K431T, V435A, T450N, L452K, V466A, D471E, T477A, H483Q, L484I, L491S, K512Q, L517I, S519N, A534S, E546K K238G
>07BR844| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICTEMEKEGKISRIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSVPL
DKDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRTKNPDIVI
YQYMDDLYVGSDLEIGQHRAKIDELREHLLKWGFITPDEKHQKEPPFLWMGYELHPDGWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTAEAE
LELAENREILKEPVHGAYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYAKMRSA
HTNDVKQLTEAVQKIAVESIVIWGKTPKFKLPILKETWDTWWTDYWQATWIPEWEFVNTP
PLVKLWYQLETEPIAGAETFYVDGAANRENKKGKAGYVTDRGRQKAVSLTETTNQKAELQ
AIQIALQDSGSEVNIVTDSQYALGIIQAQPDQSESEIVNQIIEQLIKKEKVYLSWVPAHK
GIGGNKQVDKLVSAGIRKVL

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    S17N, M50R, L101I, S119T, T124A, K136Q, V165I, V201I, A205S, I208M, T218I, L234V, D256E S283G, R284G
>07BR844| codons 1-288
FLDGIDKAQEEHEKYHNNWRAMASDFNLPPVVAKEIVASCDKCQLKGEARHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKTIHTDNGTN
FTSATVKAACWWAGIQQEFGIPYNPQSQGVVESMNKELKKIIGQIRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIISTDMQTKELQKQIIKIQNFRVYYRDSRDPVWKGPAK
LLWKGEGAVVIQDNSEIKVVPRRKAKIIRDYGKQMAGDDCVAGGQDED

References
Author Title Citation
Sanabani, SS Near full-length genome analysis of low prevalent human immunodeficiency virus type 1 subclade F1 in Sao Paulo, Brazil. Virology J, 2009