<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 PI | RTI NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    S17N, L45Q, I72V, I84L, L101I, K103R, S119T, T124A, T125A, K136R, F181L, K188R, V201I, T218L, L234V, D256E, I268L, D270H S283G
>06BR579| codons 1-288
FLDGIDKAQEEHEKYHNNWRAMASDFNLPPVVAKEIVASCDKCQQKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYLEAEVIPAETGQETAYFILRLAGRWPVKTIHTDNGTN
FTSAAVKAACWWAGIRQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
LIHNFKRRGGIGGYSAGERIIDIIATDIQTKELQKQILKIQNFRVYYRDSRDPVWKGPAK
LLWKGEGAVVIQDNSEIKVVPRRKAKILRHYGKQMAGDDCVAGRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10P, G16E, E35D, M36I, R41K, D60E, Q61N, I62V, V77I, L89M  
>06BR579| codons 1-99
PQITLWQRPPVTIKIEGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYE
NVLIEICGHKAIGTVLIGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36D, V118I, D123E, I142A, E169D, K173A, Q174K, D177E, I178L, Q207D, R211K, F214L, V245Q, E248D, A272P, T286A, E291D, V292I, I293V, P294S, E297V, F346Y, R356K, G359S, T377L, K390R, Q394L, E399D, A400T, K431T, V435A, G436E, A446S, L452K, D471E, T477A, H483Q, L491S, L517I, S519N, A534S, V559I Q91K
>06BR579| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTDICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVKLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKEFRKYTAFTIPSINNETPGARYQYNVLPQGWKGSPAIFQSSMTKILDPFRAKNPELVI
YQYMDDLYVGSDLEIGQHRTKIEELRDHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVSLTVEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPYKNLKTGKYAKMRSA
HTNDVKQLTEAVQKIALESIVIWGKTPKFRLPILKETWDTWWTEYWQATWIPEWEFVNTP
PLVKLWYQLETEPIAEAETFYVDGASNRETKKGKAGYVTDRGRQKVVSLTETTNQKAELQ
AIQLALQDSGSEVNIVTDSQYALGIIQAQPDKSESEIVNQIIEQLIKKEKVYLSWVPAHK
GIGGNEQVDKLVSAGIRKIL

References
Author Title Citation
Sanabani, SS Near full-length genome analysis of low prevalent human immunodeficiency virus type 1 subclade F1 in Sao Paulo, Brazil. Virology J, 2009