<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 PI | RTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, V82A K43T L10M, I15V, K20R, E35D, M36I, R41K, R57K, Q61N, I62V, L63P, T74S, I85V, L89T  
>06BR564| codons 1-99
PQITLWQRPMVTIKVGGQLREALLDTGADDTVLEDINLPGKWTPKLIGGIGGFIKVKQYD
NVPIEICGHKAIGSVLVGPTPANIVGRNTLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69D, K70R, T215F K219Q     K20R, A33G, V35T, K49R, D123E, S162C, E169D, K173A, Q174K, I178L, G196E, T200A, Q207K, R211A, F214L, V245K, E248D, A272P, V276T, K277R, T286A, E291D, V292I, I293V, E297A, D324E, R356K, M357V, G359S, A371V, A376S, T377L, S379C, Q394S, E399D, A400T, K431T, V435L, A446S, L452Q, V466A, D471E, T477A, H483Q, L491S, K512Q, S519N, K527Q, E529D, A534S V254I
>06BR564| codons 1-560
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKGLTEICTEMEKEGKISRIGPENPYNTPV
FAIKKKDSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRAKNPDLVI
YQYMDDLYVGSDLEIEQHRAKIEELRKHLLAWGLFTPDQKHQKEPPFLWMGYELHPDKWT
VQPIKLPDKDSWTINDIQKLVGKLNWASQIYPGIKTRQLCKLLRGAKALTDIVPLTAEAE
LELAENREILKEPVHGVYYDPSKELIAEIQKQGQGQWTYQIYQEPFKNLKTGKYAKVRSA
HTNDVKQLTEVVQKISLECIVIWGKTPKFKLPISKETWDTWWTEYWQATWIPEWEFVNTP
PLVKLWYQLETEPILGAETFYVDGASNRETKQGKAGYVTDRGRQKAVSLTETTNQKAELQ
AIQLALQDSGSEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIQKDKVYLSWVPAHK
GIGGNEQVDKLVSAGIRKVL

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    S17N, D25E, L68S, I72V, I84L, L101I, T112V, S119T, T124A, T125A, A129V, V201I, A205S, K211R, T218I, L234V, D256E S283G
>06BR564| codons 1-288
FLDGIDKAQEEHEKYHNNWRAMASEFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHSEGKVILVAVHVASGYLEAEVIPAETGQETAYFILKLAGRWPVKVIHTDNGTN
FTSAAVKAVCWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIISTDIQTRELQKQIIKIQNFRVYYRDSRDPVWKGPAK
LLWKGEGAVVIQDNSEIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

References
Author Title Citation
Sanabani, SS Near full-length genome analysis of low prevalent human immunodeficiency virus type 1 subclade F1 in Sao Paulo, Brazil. Virology J, 2009