<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 PI | RTI 52

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I3V, L10P, T12A, I15V, K20R, E35D, M36I, R41K, R57K, Q61N, L63P, L89M  
>02BR082| codons 1-99
PQVTLWQRPPVAIKVGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
NIPIEICGHKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T215Y       V35T, E36A, K102Q, S162C, E169D, K173T, Q174K, Q207E, R211K, E224D, V245Q, E248D, A272P, T286A, A288T, E291D, V292I, I293V, E297A, K347Q, R356K, G359T, T377Q, Q394L, E399N, A400T, K431T, V435A, A446S, E449D, L452E, V466A, S468F, D471E, T477A, H483Q, L491S, S519N, E523D, A534S Y127D, D185N
>02BR082| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQKKSVTVLDVGDAYFSVPL
DKDFRKDTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRTKNPDIVI
YQYMNDLYVGSDLEIGQHRTKIEELREHLLKWGFYTPDKKHQKDPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKTLTDIVPLTAEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFQNLKTGKYAKMRTA
HTNDVKQLTEAVQKIAQESIVIWGKTPKFKLPILKETWNTWWTEYWQATWIPEWEFVNTP
PLVKLWYQLETEPIAGAETFYVDGASNRDTKEGKAGYVTDRGRQKAVFLTETTNQKAELQ
AIQLALQDSGSEVNIVTDSQYALGIIQAQPDKSESELVNQIIDQLIKKEKVYLSWVPAHK
GIGGNEQVDKLVSAGIRKVL

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
  G163R S17N, I72V, I84L, L101I, T112I, S119T, T122I, T124A, T125P, K136Q, H171Y, V201I, A205S, K211R, T218I, L234V, D256E S283G
>02BR082| codons 1-288
FLDGIDKAQEEHEKYHNNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYLEAEVIPAETGQETAYFILKLAGRWPVKIIHTDNGTN
FISAPVKAACWWAGIQQEFGIPYNPQSQGVVESMNKELKKIIRQVRDQAEYLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIISTDIQTRELQKQIIKIQNFRVYYRDSRDPVWKGPAK
LLWKGEGAVVIQDNSEIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

References
Author Title Citation
Sanabani, SS Near full-length genome analysis of low prevalent human immunodeficiency virus type 1 subclade F1 in Sao Paulo, Brazil. Virology J, 2009