<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 Unknown NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    V32I, M50T, L101I, T112V, T124N, K136Q, K156R, I203M, L234I V281M
>02.BR.HF31| codons 1-288
FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVIAKEIVASCDKCQLKGEATHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKVIHTDNGSN
FTSNTVKAACWWAGIQQEFGIPYNPQSQGVVESMNRELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDMIATDIQTKELQKQITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCMASRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, G16E, M36I, N37K, R41K, H69K, I93L  
>02.BR.HF31| codons 1-99
PQITLWQRPLVTIKVEGQLKEALLDTGADDTVLEEIKLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36A, T39D, K43R, S48T, K122E, D123S, I135T, S162C, R211K, V245Q, D250E, A272P, T286A, E291D, V292I, I293V, I329L, R356K, G359T, K366R, T377Q, K390R, E404D, R448K, L452M, V466I, S468P, D471E, H483Q, L491S, A508T, S519N, K530R, A534S, A554Q D76DH
>02.BR.HF31| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICDEMEREGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVHFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAELQKQGQGQWTYQIYQEPFKNLKTGKYAKMRTA
HTNDVRQLTEAVQKIAQESIVIWGKTPKFRLPIQKETWEAWWTDYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANKETKMGKAGYVTDRGRQKIVPLTETTNQKTELQ
AIQLALQDSGSEVNIVTDSQYALGIIQTQPDKSESELVNQIIEQLIKKERVYLSWVPAHK
GIGGNEQVDKLVSQGIRKVL

References
Author Title Citation
Passaes, CP Near full-length genome characterization of HIV type 1 unique BC recombinant forms from southern Brazil. ARHR, 2009