<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
316_07 BR07SC316 Brazil 2007 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC|D4T|NFV NA
2 3TC|AZT|LPV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32VI, I47A   T12P, I13V, I15V, Q18L, K20T, M36I, K45R, D60E, Q61E, I62V, L63P, C67Y, L89IM  
>BR07SC316| codons 1-99
PQITLWQRPLVPVKVGGLLTEALLDTGADDTILEEINLPGRWKPRMAGGIGGFIKVRQYE
EVPIEIYGHKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Rodrigues, R Young pregnant women living with HIV/AIDS in Criciuma, southern Brazil, are infected almost exclusively with HIV type 1 clade C. ARHR, 2010