<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC|D4T|NFV NA
2 3TC|AZT|LPV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32VI, I47A   T12P, I13V, I15V, Q18L, K20T, M36I, K45R, D60E, Q61E, I62V, L63P, C67Y, L89IM  
>BR07SC316| codons 1-99
PQITLWQRPLVPVKVGGLLTEALLDTGADDTILEEINLPGRWKPRMAGGIGGFIKVRQYE
EVPIEIYGHKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Rodrigues, R Young pregnant women living with HIV/AIDS in Criciuma, southern Brazil, are infected almost exclusively with HIV type 1 clade C. ARHR, 2010