<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
353_07 BR07SC353 Brazil 2007 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC|AZT|EFV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V T215TI, K219Q V106M F227FL V35T, E36A, T39D, S48T, K101A, K122E, I135T, E169D, D177E, T200A, I202V, Q207A, R211K  
>BR07SC353| codons 1-235
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICDEMEKEGKITKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLAKKKSMTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHRAKVEELRAHLLKWGFITPDQKHQKEPPLLWMGYELH

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, L19I, M36L, N37K, R41N, H69K, L89M, I93L  
>BR07SC353| codons 1-99
PQITLWQRPLVTIKVGGQIKEALLDTGADDTVLEELKLPGNWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Rodrigues, R Young pregnant women living with HIV/AIDS in Criciuma, southern Brazil, are infected almost exclusively with HIV type 1 clade C. ARHR, 2010