<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
339_07 BR07SC339 Brazil 2007 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC|AZT|NFV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, L19Q, M36I, N37K, R41N, D60DE, Q61QE, L63LIPT, H69K, L89M, I93L  
>BR07SC339| codons 1-99
PQITLWQRPLVTIKVGGQQKEALLDTGADDTVLEEIKLPGNWKPKMIGGIGGFIKVRQYE
EITIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103N V108VI K20KR, V35T, T39L, V90I, S162Y, F171Y, K173T, Q174K, E203D, Q207E, R211K, F214L  
>BR07SC339| codons 1-228
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICLEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKNKSVTILDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPYRTKNPDIVI
YQYVDDLYVGSDLEIGQHRTKIDELREHLLKWGLTTPDKKHQKEPPFL

References
Author Title Citation
Rodrigues, R Young pregnant women living with HIV/AIDS in Criciuma, southern Brazil, are infected almost exclusively with HIV type 1 clade C. ARHR, 2010