<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
329_07 BR07SC329 Brazil 2007 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC|AZT|LPV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    N37K, R41N, H69K, I93L  
>BR07SC329| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMKLPGNWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36A, T39E, K43R, S48T, V60I, T107S, K122E, D123S, K173T, D177G, T200A, Q207T, R211K  
>BR07SC329| codons 1-238
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEREGKITKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVSVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTQNPGIVI
YQYMDDLYVGSDLEIGQHRAKIEELRTHLLKWGFTTPDKKHQKEPPFLWMGYELHPDK

References
Author Title Citation
Rodrigues, R Young pregnant women living with HIV/AIDS in Criciuma, southern Brazil, are infected almost exclusively with HIV type 1 clade C. ARHR, 2010