<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
322_07 BR07SC322 Brazil 2007 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC|AZT|NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35Q, T39D, S48T, V60I, K122E, D123S, I135R, S162C, D177E, V179I, T200E, R211K  
>BR07SC322| codons 1-239
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALQEICDEMEKEGKITKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPEIII
YQYMDDLYVGSDLEIGQHREKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, L19T, M36I, N37K, R41I, L63P, H69K, K70R, A71T, I93L  
>BR07SC322| codons 13-99
IKVGGQTKEALLDTGADDTVLEEIKLPGIWKPKMIGGIGGFIKVRQYDQIPIEICGKRTI
GTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Rodrigues, R Young pregnant women living with HIV/AIDS in Criciuma, southern Brazil, are infected almost exclusively with HIV type 1 clade C. ARHR, 2010