<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 DDI|3TC|NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V, M184V   Y181C V108I V8I, V35Q, E36A, T39D, S48T, V60I, D121H, K122E, K166R, K173A, D177E, T200V, Q207A, R211K, H221Y, V245E, S251N  
>TRCFRT13| codons 1-251
PISPIETIPVKLKPGMDGPKVKQWPLTEEKIKALQAICDEMEKEGKITKIGPENPYNTPI
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTILDVGDAYFSVPL
HEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRAQNPEIVI
CQYVDDLYVGSDLEIGQHRVKIEELRAHLLKWGFTTPDKKYQKEPPFLWMGYELHPDKWT
VQPIELPEKDN

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15IV, L19IT, E35D, M36I, P39Q, R41K, K45R, D60E, L63P, H69K, I72V, L89M, I93L  
>TRCFPR13| codons 1-99
PQITLWQRPLVTIKVGGQTKEALLDTGADDTVLEDINLQGKWKPRMIGGIGGFIKVRQYE
QIPIEICGKKAVGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Rajesh, L Antiretroviral drug-resistant mutations at baseline and at time of failure of antiretroviral therapy in HIV type 1-coinfected TB patients. ARHR, 2009