<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 DDI|3TC|NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74LV, M184V K219KE K103N, Y181C   V35T, T39N, S48T, V60I, V90I, D121H, K122E, I142IV, S162A, E169K, K173E, I178L, T200A, Q207E, R211K, V245E K30E, I31P
>TRCFRT12| codons 7-249
TVPVKLKPGMDGPKVKQWPLTEEEPKALTEICNEMEKEGKITKIGPENPYNTPIFAIKKK
DSTKWRKVVDFRELNKRTQDFWEIQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLHEDFRK
YTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQASMTKILKPFREQNPDLVICQYVDD
LYVGSDLEIGQHRAKIEELREHLLKWGFTTPDEKHQKEPPFLWMGYELHPDKWTVQPIEL
PEK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L19I, M36MLV, N37ST, P39S, R41K, I62V, L63Q, H69K, A71T, I93L  
>TRCFPR12| codons 18-99
QIKEALLDTGADDTVLEEVTLSGKWKPKMIGGIGGFIKVRQYDQVQIEICGKKTIGTVLV
GPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Rajesh, L Antiretroviral drug-resistant mutations at baseline and at time of failure of antiretroviral therapy in HIV type 1-coinfected TB patients. ARHR, 2009