<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 DDI|3TC|NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65KR, M184MI   K101KE, K103KN, Y181C   V35T, E36A, T39D, S48T, K49KR, V60I, D121HY, K122E, T165I, K173A, Q174QK, D177E, I178M, T200A, Q207E, R211RK, V245Q  
>TRCFRT1| codons 6-249
ETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICDEMEKEGKITRIGPENPYNTPIFAIKR
KDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKNKSVTVLDVGDAYFSVPLYEDFR
KYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMIKILEPFRAKNPEMVICQYID
DLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIQ
LPEK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35D, M36I, N37D, R41K, R57K, H69K, K70R, L89M  
>TRCFPR1| codons 28-99
ADDTVLEDIDLPGKWKPKMIGGIGGFIKVKQYDQILIEICGKRAIGTVLVGPTPVNIIGR
NMLTQIGCTLNF

References
Author Title Citation
Rajesh, L Antiretroviral drug-resistant mutations at baseline and at time of failure of antiretroviral therapy in HIV type 1-coinfected TB patients. ARHR, 2009