<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CE97R98 CE97R98 Romania 1997 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, T12K, I15V, K20R, E35D, M36I, R41K, R57K, Q58X, L63T, E65D, L89M  
>CE97R98| codons 5-99
LWQRPVVKIKVGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKHYDQITI
DICGHKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E44D, D123E, I135T, S162C, K173T, Q174R, I178L, I195L, I202V, Q207A, I244V, V245Q, A272P, K277R, T286A  
>CE97R98| codons 1-289
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKDGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRTRNPDLVI
YQYMDDLYVGSDLELGQHRTKVEELRAHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPVQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKAL

References
Author Title Citation
Op de Coul, E Genetic evidence of multiple transmissions of HIV type 1 subtype F within Romania from adult blood donors and to children. ARHR, 2000